PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000334047
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 308aa    MW: 35617.5 Da    PI: 6.7925
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000334047genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.7e-50151391128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeelv++y ++k+++++l +  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +  
  MDP0000334047  15 LPPGFRFHPTDEELVNHYXCRKCASQPLAV-PIIREIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKHIGK-- 107
                    79*************************999.88***************7666789*************************************98.. PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ g+kk Lvfy g+apkg kt+W+mheyrl
  MDP0000334047 108 PKALGIKKALVFYAGKAPKGIKTNWIMHEYRL 139
                    778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6110168IPR003441NAC domain
PROSITE profilePS5100559.06315168IPR003441NAC domain
PfamPF023653.9E-2616139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSGGGDEQQQ QQLELPPGFR FHPTDEELVN HYXCRKCASQ PLAVPIIREI DLYKFDPWQL  60
PEMALYGEKE WYFFSPRDRK YPNGSRPNRA AGTGYWKATG ADKHIGKPKA LGIKKALVFY  120
AGKAPKGIKT NWIMHEYRLA NVDRSAAAAK KNQNLRLDDW VLCRIYNKKG SIEKYNVTTK  180
MTKYPEIXDE QKPDMTIMPP PPHAASNTHH MMDSSMDSVP RLPQTTTDYS SCSEHVLSPE  240
VTWEKEVQSE LKWSNQLENS FNTLDNQFLN YMDGFSDIMD PFGGQLQMEQ QQPYQLQDMY  300
SYLHTQFX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-8161746174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.246950.0bud| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981290.0KF198129.1 Malus hupehensis NAC domain protein (NAC143) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008394193.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-120NAC2_ARATH; NAC domain-containing protein 2
TrEMBLS5R9660.0S5R966_9R
STRINGGLYMA06G16440.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-114NAC family protein